Ydacha / Товары для дома и дачи купить в Минске

Robots.txt Information

Robot	Path	Permission
GoogleBot	/	✔
BingBot	/	✔
BaiduSpider	/	✔
YandexBot	/	✔

Meta Tags

Title	Товары для дома и дачи купить в Минске \| Интернет-магазин Ydacha.by
Description	Интернет-магазин товаров для дома, дачи, сада и огорода ⭐ Удача.бай ⭐ теплицы ➤ парники ➤ поликарбонат ➤ беседки купить в Минске ✅️ Доставка по Беларуси
Keywords	интернет-магазин товаров для дома дачи и сада

Server Information

WebSite	www.ydacha.by
Host IP	178.172.137.109
Location	Navapolatsk, Vitebsk, Belarus

Related Websites

                    Site
                    Rank
                

More to Explore

managehighlyrefinedthefile.vip

Ydacha.by Valuation

US$188,086

Last updated: May 28, 2023

Ydacha.by has global traffic rank of 458,709. Ydacha.by has an estimated worth of US$ 188,086, based on its estimated Ads revenue. Ydacha.by receives approximately 6,870 unique visitors each day. Its web server is located in Navapolatsk, Vitebsk, Belarus, with IP address 178.172.137.109. According to SiteAdvisor, ydacha.by is safe to visit.

Traffic & Worth Estimates

Purchase/Sale Value	US$188,086
Daily Ads Revenue	US$103
Monthly Ads Revenue	US$3,091
Yearly Ads Revenue	US$37,617
Daily Unique Visitors	6,870
Note: All traffic and earnings values are estimates.

Traffic Ranks

Global Rank	458,709
Delta (90 Days)	0
Most Popular In Country	N/A
Country Rank	N/A

DNS Records

Host	Type	TTL	Data
ydacha.by	A	21600	IP: 178.172.137.109
ydacha.by	NS	600	Target: u1.hoster.by.
ydacha.by	NS	600	Target: u2.hoster.by.
ydacha.by	SOA	600	MNAME: u1.hoster.by. RNAME: support.hoster.by. Serial: 2022012506 Refresh: 43200 Retry: 7200 Expire: 604800 Minimum TTL: 600

HTTP Headers

HTTP/1.1 301 Moved Permanently
Server: nginx/1.20.2
Date: Sun, 28 May 2023 14:06:10 GMT
Content-Type: text/html
Content-Length: 169
Connection: keep-alive
Location: https://ydacha.by:443/

HTTP/2 200 
server: nginx/1.20.2
date: Sun, 28 May 2023 14:06:11 GMT
content-type: text/html; charset=utf-8
x-powered-by: PHP/7.3.33
cache-control: private, no-cache, no-store
set-cookie: SESSdbddd7614466bf23510a5f8656c751de=f54f2524ecc5a3a36206c8b435f64b7f; path=/; HttpOnly
last-modified: Tue, 23 May 2023 14:42:42 GMT
strict-transport-security: max-age=31536000;

Ydacha.by Whois Information

Domain name: ydacha.by
Registrar: Reliable Software, Ltd
Org: ООО "ГазТеплоТорг"
Country: BY
Address: 220140, -, г. Минск, ул. Домбровская, д. 10, к. 32
Registration or other identification number: 192822569
Phone: +375293813398
Email: HIDDEN! Details are available at https://whois.cctld.by
Name Server: u1.hoster.by
Name Server: u2.hoster.by
Update Date: 2022-01-25
Creation Date: 2020-11-27
Expiration Date: 2023-11-27

-------------------------------------------
Service provided by Belarusian Cloud Technologies LLC

Ydacha.by valuation and analysis